PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.18327s0004.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 314aa    MW: 35927.7 Da    PI: 8.615
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.18327s0004.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.89.2e-32207261256
               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                           +r+rW+++LH++Fv+a+++LGG+++AtPk+i++lmkv+gLt+++vkSHLQkYR++
  Araha.18327s0004.1.p 207 QRRRWSQDLHRKFVDALHRLGGPQVATPKQIRDLMKVDGLTNDEVKSHLQKYRMH 261
                           8****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-28203264IPR009057Homeodomain-like
SuperFamilySSF466892.66E-17203264IPR009057Homeodomain-like
PROSITE profilePS5129412.598203263IPR017930Myb domain
TIGRFAMsTIGR015574.0E-25207261IPR006447Myb domain, plants
PfamPF002491.7E-7208259IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MVQTETDQRM GLNLDLSIYS LPKPLSQFLD QVSRIKDNHS KLSEIDGYVG KLEEERKKID  60
VFRRELPLCM LLLNEAIEAL NEARKGSSVM ASNGKFDERE GAKPETDKKS WMSSAQLWIS  120
NPNSQLQSTN EEEDRCVSQN PFQTCNYPNQ GGAFLPFNPP PPPAPLSLMT PTSDMMMDCS  180
RIEQNHHHHH QFNKPSSQSH HIQKKEQRRR WSQDLHRKFV DALHRLGGPQ VATPKQIRDL  240
MKVDGLTNDE VKSHLQKYRM HIRKHPLHPT KTLSSSDQPG VLERESQSLI SLSRSDSPQS  300
PLAYQLMLYM LKT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3166640.0AK316664.1 Arabidopsis thaliana AT4G37180 mRNA, complete cds, clone: RAFL06-70-N17.
GenBankBT0289850.0BT028985.1 Arabidopsis thaliana At4g37180 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568018.10.0myb family transcription factor
TrEMBLB9DF770.0B9DF77_ARATH; AT4G37180 protein
TrEMBLQ08A940.0Q08A94_ARATH; At4g37180
STRINGAT4G37180.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-170G2-like family protein